Loading...
Statistics
Advertisement

Главная
www.xn--c1axfc3d.xn--p1ai/

Xn--c1axfc3d.xn--p1ai

Domain is redirected to: Spges.ru
Advertisement
Xn--c1axfc3d.xn--p1ai is hosted in Russian Federation / Saratov . Xn--c1axfc3d.xn--p1ai doesn't use HTTPS protocol. Number of used technologies: 6. First technologies: CSS, Html, Iframe, Number of used javascripts: 12. First javascripts: Mootools-core.js, Core.js, Modal.js, Number of used analytics tools: 0. Number of used plugins, modules: 1. Its server type is: nginx/1.4.4.

Technologies in use by Xn--c1axfc3d.xn--p1ai

Technology

Number of occurences: 6
  • CSS
  • Html
  • Iframe
  • Javascript
  • Swf Object
  • Yandex.Metrika

Advertisement

Javascripts

Number of occurences: 12
  • mootools-core.js
  • core.js
  • modal.js
  • caption.js
  • jquery-1.4.3.min.js
  • jquery.mousewheel-3.0.4.pack.js
  • jquery.fancybox-1.3.4.js
  • jpopmessages_mootools.min.js
  • swfobject.js
  • orphus.js
  • watch.js

Server Type

  • nginx/1.4.4

Powered by

  • PHP/5.2.9

Used plugins, modules

Number of plugins and modules: 1
  • mod flexbanners

Conversion rate optimization

visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Xn--c1axfc3d.xn--p1ai

Missing HTTPS protocol.

    Meta - Xn--c1axfc3d.xn--p1ai

    Number of occurences: 3
    • Name:
      Content: 1800
    • Name: author
      Content: alina
    • Name: generator
      Content: Joomla! - Open Source Content Management

    Server / Hosting

    • IP: 217.23.67.67
    • Latitude: 51.54
    • Longitude: 46.01
    • Country: Russian Federation
    • City: Saratov

    Rname

    • ns3-fwl2.nic.ru
    • ns4-fwl2.nic.ru
    • ns8-fwl2.nic.ru
    • mf1.nic.ru

    Target

    • support.nic.ru

    HTTP Header Response

    HTTP/1.1 302 Found Server: nginx/1.4.4 Date: Wed, 12 Oct 2016 04:09:15 GMT Content-Type: text/html Content-Length: 160 Location: http://spges.ru X-Cache: MISS from s_sh11 Via: 1.1 s_sh11 (squid/3.5.20) Connection: keep-alive HTTP/1.1 200 OK Date: Wed, 12 Oct 2016 04:09:14 GMT Server: Apache/2.2.11 (FreeBSD) DAV/2 PHP/5.2.9 with Suhosin-Patch mod_ssl/2.2.11 OpenSSL/0.9.8e X-Powered-By: PHP/5.2.9 Set-Cookie: 78840b8ea59456b4af98a9feba01a8ea=d77969qtkbsa7qd0jmt7j13tq4; path=/ P3P: CP="NOI ADM DEV PSAi COM NAV OUR OTRo STP IND DEM" Cache-Control: no-cache Pragma: no-cache Content-Type: text/html; charset=utf-8 X-Cache: MISS from s_sh11 Transfer-Encoding: chunked Via: 1.1 s_sh11 (squid/3.5.20) Connection: keep-alive

    DNS

    host: xn--c1axfc3d.xn--p1ai
    1. class: IN
    2. ttl: 3600
    3. type: A
    4. ip: 109.70.27.4
    host: xn--c1axfc3d.xn--p1ai
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: ns3-fwl2.nic.ru
    host: xn--c1axfc3d.xn--p1ai
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: ns4-fwl2.nic.ru
    host: xn--c1axfc3d.xn--p1ai
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: ns8-fwl2.nic.ru
    host: xn--c1axfc3d.xn--p1ai
    1. class: IN
    2. ttl: 3600
    3. type: SOA
    4. mname: ns3-fwl2.nic.ru
    5. rname: support.nic.ru
    6. serial: 1
    7. refresh: 14400
    8. retry: 3600
    9. expire: 2592000
    10. minimum-ttl: 600
    host: xn--c1axfc3d.xn--p1ai
    1. class: IN
    2. ttl: 3600
    3. type: MX
    4. pri: 5
    5. target: mf1.nic.ru

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.n--c1axfc3d.xn--p1ai, www.xqn--c1axfc3d.xn--p1ai, www.qn--c1axfc3d.xn--p1ai, www.xn--c1axfc3d.xn--p1ai, www.n--c1axfc3d.xn--p1ai, www.xan--c1axfc3d.xn--p1ai, www.an--c1axfc3d.xn--p1ai, www.xsn--c1axfc3d.xn--p1ai, www.sn--c1axfc3d.xn--p1ai, www.xdn--c1axfc3d.xn--p1ai, www.dn--c1axfc3d.xn--p1ai, www.xen--c1axfc3d.xn--p1ai, www.en--c1axfc3d.xn--p1ai, www.x--c1axfc3d.xn--p1ai, www.xnn--c1axfc3d.xn--p1ai, www.xn--c1axfc3d.xn--p1ai, www.xnh--c1axfc3d.xn--p1ai, www.xh--c1axfc3d.xn--p1ai, www.xnj--c1axfc3d.xn--p1ai, www.xj--c1axfc3d.xn--p1ai, www.xnk--c1axfc3d.xn--p1ai, www.xk--c1axfc3d.xn--p1ai, www.xnl--c1axfc3d.xn--p1ai, www.xl--c1axfc3d.xn--p1ai, www.xn --c1axfc3d.xn--p1ai, www.x --c1axfc3d.xn--p1ai, www.xn-c1axfc3d.xn--p1ai, www.xn-t-c1axfc3d.xn--p1ai, www.xnt-c1axfc3d.xn--p1ai, www.xn-g-c1axfc3d.xn--p1ai, www.xng-c1axfc3d.xn--p1ai, www.xn-h-c1axfc3d.xn--p1ai, www.xnh-c1axfc3d.xn--p1ai, www.xn-u-c1axfc3d.xn--p1ai, www.xnu-c1axfc3d.xn--p1ai, www.xn-j-c1axfc3d.xn--p1ai, www.xnj-c1axfc3d.xn--p1ai, www.xn-x-c1axfc3d.xn--p1ai, www.xnx-c1axfc3d.xn--p1ai, www.xn-s-c1axfc3d.xn--p1ai, www.xns-c1axfc3d.xn--p1ai, www.xn-a-c1axfc3d.xn--p1ai, www.xna-c1axfc3d.xn--p1ai, www.xn--c1axfc3d.xn--p1ai, www.xn-c1axfc3d.xn--p1ai, www.xn- -c1axfc3d.xn--p1ai, www.xn -c1axfc3d.xn--p1ai, www.xn-c1axfc3d.xn--p1ai, www.xn--tc1axfc3d.xn--p1ai, www.xn-tc1axfc3d.xn--p1ai, www.xn--gc1axfc3d.xn--p1ai, www.xn-gc1axfc3d.xn--p1ai, www.xn--hc1axfc3d.xn--p1ai, www.xn-hc1axfc3d.xn--p1ai, www.xn--uc1axfc3d.xn--p1ai, www.xn-uc1axfc3d.xn--p1ai, www.xn--jc1axfc3d.xn--p1ai, www.xn-jc1axfc3d.xn--p1ai, www.xn--xc1axfc3d.xn--p1ai, www.xn-xc1axfc3d.xn--p1ai, www.xn--sc1axfc3d.xn--p1ai, www.xn-sc1axfc3d.xn--p1ai, www.xn--ac1axfc3d.xn--p1ai, www.xn-ac1axfc3d.xn--p1ai, www.xn--c1axfc3d.xn--p1ai, www.xn-c1axfc3d.xn--p1ai, www.xn-- c1axfc3d.xn--p1ai, www.xn- c1axfc3d.xn--p1ai, www.xn--1axfc3d.xn--p1ai, www.xn--cd1axfc3d.xn--p1ai, www.xn--d1axfc3d.xn--p1ai, www.xn--cr1axfc3d.xn--p1ai, www.xn--r1axfc3d.xn--p1ai, www.xn--ct1axfc3d.xn--p1ai, www.xn--t1axfc3d.xn--p1ai, www.xn--cv1axfc3d.xn--p1ai, www.xn--v1axfc3d.xn--p1ai, www.xn--cf1axfc3d.xn--p1ai, www.xn--f1axfc3d.xn--p1ai, www.xn--cg1axfc3d.xn--p1ai, www.xn--g1axfc3d.xn--p1ai, www.xn--ch1axfc3d.xn--p1ai, www.xn--h1axfc3d.xn--p1ai, www.xn--cn1axfc3d.xn--p1ai, www.xn--n1axfc3d.xn--p1ai, www.xn--cm1axfc3d.xn--p1ai, www.xn--m1axfc3d.xn--p1ai, www.xn--cj1axfc3d.xn--p1ai, www.xn--j1axfc3d.xn--p1ai, www.xn--caxfc3d.xn--p1ai, www.xn--c1laxfc3d.xn--p1ai, www.xn--claxfc3d.xn--p1ai, www.xn--c10axfc3d.xn--p1ai, www.xn--c0axfc3d.xn--p1ai, www.xn--c19axfc3d.xn--p1ai, www.xn--c9axfc3d.xn--p1ai, www.xn--c1xfc3d.xn--p1ai, www.xn--c1aoxfc3d.xn--p1ai, www.xn--c1oxfc3d.xn--p1ai, www.xn--c1apxfc3d.xn--p1ai, www.xn--c1pxfc3d.xn--p1ai, www.xn--c1a9xfc3d.xn--p1ai, www.xn--c19xfc3d.xn--p1ai, www.xn--c1axfc3d.xn--p1ai, www.xn--c1xfc3d.xn--p1ai, www.xn--c1aixfc3d.xn--p1ai, www.xn--c1ixfc3d.xn--p1ai, www.xn--c1auxfc3d.xn--p1ai, www.xn--c1uxfc3d.xn--p1ai, www.xn--c1afc3d.xn--p1ai, www.xn--c1axqfc3d.xn--p1ai, www.xn--c1aqfc3d.xn--p1ai, www.xn--c1axfc3d.xn--p1ai, www.xn--c1afc3d.xn--p1ai, www.xn--c1axafc3d.xn--p1ai, www.xn--c1aafc3d.xn--p1ai, www.xn--c1axsfc3d.xn--p1ai, www.xn--c1asfc3d.xn--p1ai, www.xn--c1axdfc3d.xn--p1ai, www.xn--c1adfc3d.xn--p1ai, www.xn--c1axefc3d.xn--p1ai, www.xn--c1aefc3d.xn--p1ai, www.xn--c1axc3d.xn--p1ai, www.xn--c1axfqc3d.xn--p1ai, www.xn--c1axqc3d.xn--p1ai, www.xn--c1axfc3d.xn--p1ai, www.xn--c1axc3d.xn--p1ai, www.xn--c1axfac3d.xn--p1ai, www.xn--c1axac3d.xn--p1ai, www.xn--c1axfyc3d.xn--p1ai, www.xn--c1axyc3d.xn--p1ai, www.xn--c1axftc3d.xn--p1ai, www.xn--c1axtc3d.xn--p1ai, www.xn--c1axfgc3d.xn--p1ai, www.xn--c1axgc3d.xn--p1ai, www.xn--c1axfbc3d.xn--p1ai, www.xn--c1axbc3d.xn--p1ai, www.xn--c1axfwc3d.xn--p1ai, www.xn--c1axwc3d.xn--p1ai, www.xn--c1axfsc3d.xn--p1ai, www.xn--c1axsc3d.xn--p1ai, www.xn--c1axfdc3d.xn--p1ai, www.xn--c1axdc3d.xn--p1ai, www.xn--c1axfrc3d.xn--p1ai, www.xn--c1axrc3d.xn--p1ai, www.xn--c1axf3c3d.xn--p1ai, www.xn--c1ax3c3d.xn--p1ai, www.xn--c1axf4c3d.xn--p1ai, www.xn--c1ax4c3d.xn--p1ai, www.xn--c1axf3d.xn--p1ai, www.xn--c1axfcd3d.xn--p1ai, www.xn--c1axfd3d.xn--p1ai, www.xn--c1axfcr3d.xn--p1ai, www.xn--c1axfr3d.xn--p1ai, www.xn--c1axfct3d.xn--p1ai, www.xn--c1axft3d.xn--p1ai, www.xn--c1axfcv3d.xn--p1ai, www.xn--c1axfv3d.xn--p1ai, www.xn--c1axfcf3d.xn--p1ai, www.xn--c1axff3d.xn--p1ai, www.xn--c1axfcg3d.xn--p1ai, www.xn--c1axfg3d.xn--p1ai, www.xn--c1axfch3d.xn--p1ai, www.xn--c1axfh3d.xn--p1ai, www.xn--c1axfcn3d.xn--p1ai, www.xn--c1axfn3d.xn--p1ai, www.xn--c1axfcm3d.xn--p1ai, www.xn--c1axfm3d.xn--p1ai, www.xn--c1axfcj3d.xn--p1ai, www.xn--c1axfj3d.xn--p1ai,

    Other websites we recently analyzed

    1. News Perspective Publishing
      San Jose (United States) - 198.38.82.168
      Server software: - Web acceleration by http://www.unixy.net/varnish
      Technology: CSS, Html, Html5, Iframe, Javascript, jQuery, Php, Pingback
      Number of Javascript: 5
      Number of meta tags: 2
    2. weddingplanningrealitycheck.info
      Scottsdale (United States) - 50.63.202.52
      Server software: squid/3.5.12
      Technology: Html, Html5, Iframe
    3. Скрап-маньяки. Скрапбукинг. Украина. Мой любимый интернет-магазин для скрапбукинга и тильд
      Ищете скрапбукинг и тильды в Украине? Вам сюда! Это интернет-магазин Скрапманьяки. В нем потрясающий выбор товаров для скрапбукинга и тильд, он поднимает настроение и дарит вдохновение заниматься любимым хобби! Бесплатная доставка по Украине от 450 грн :) Заходите, я вас жду! Ваш Скрапманьяк.
      West Chester (United States) - 162.248.50.46
      Server software: Apache
      Technology: Carousel, CSS, Html, Html5, Javascript, jQuery Cookie, jQuery Hover Intent, jQuery UI, Php
      Number of Javascript: 9
      Number of meta tags: 2
    4. Home - SpudPress
      Milano (Italy) - 149.154.157.190
      G Analytics ID: UA-36045075-10
      Server software: nginx
      Technology: BootstrapCDN, CloudFlare, Maxcdn, CSS, Font Awesome, Html, Javascript, Php, Google Analytics, Wordpress, Twitter Button
      Number of Javascript: 5
      Number of meta tags: 13
    5. wallclimbers.info
      Germany - 217.160.231.221
      Server software: Apache
      Technology: Html
      Number of meta tags: 1
    6. »ä½¿è¯–
      Cheyenne (United States) - 23.224.80.104
      Server software: Microsoft-IIS/7.5
      Technology: CSS, Html, Javascript
      Number of Javascript: 2
      Number of meta tags: 9
    7. Nilzzon
      Norway - 91.207.158.157
      Server software: nginx
      Technology: Html, Php
      Number of Javascript: 1
      Number of meta tags: 4
    8. Amrita Yoga Magazine | by Yoga Alliance Professionals
      United Kingdom - 212.67.220.87
      G Analytics ID: UA-75003137-1
      Server software: Apache/2.2.22
      Technology: CSS, Flexslider, Font Awesome, Google Font API, Html, Html5, Javascript, jQuery, Lightbox, Php, Pingback, Revslider, Google Analytics, Wordpress, Share This Social Media Buttons
      Number of Javascript: 16
      Number of meta tags: 3
    9. Die Menschen - Caprina
      Switzerland - 185.101.158.33
      Server software: Apache/2.2.22 (Debian)
      Technology: CSS, Google Font API, Html, Html5, Javascript, jQuery
      Number of Javascript: 11
      Number of meta tags: 4
    10. SUia.com
      United Kingdom - 176.74.176.186
      Server software: Apache/2.2.22 (Ubuntu)
      Technology: Html, Javascript, Php
      Number of Javascript: 2
      Number of meta tags: 1

    Check Other Websites